PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G137101.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 684aa    MW: 70541.6 Da    PI: 10.1315
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G137101.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41e-15365410147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg W + Ed +l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  Sobic.007G137101.1.p 365 RGHWRPAEDAKLRELVALYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 410
                           899*****************************.***********996 PP

2Myb_DNA-binding51.13.2e-16418460246
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            +++ eE+e+l  a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Sobic.007G137101.1.p 418 RPFSDEEEERLMAAHRFYGNK-WAMIARLFP-GRTDNAVKNHWHV 460
                           689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.78360411IPR017930Myb domain
SMARTSM007176.1E-14364413IPR001005SANT/Myb domain
SuperFamilySSF466893.11E-27365458IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-25366418IPR009057Homeodomain-like
CDDcd001671.35E-12368409No hitNo description
PfamPF139212.2E-15368428No hitNo description
PROSITE profilePS5129424.91412466IPR017930Myb domain
SMARTSM007174.9E-13416464IPR001005SANT/Myb domain
CDDcd001672.74E-10419459No hitNo description
Gene3DG3DSA:1.10.10.601.1E-19419465IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MSKARANVAG VGRVDEAVRA CVRACVRARL ARGQSGSGTV RAGLPPVQLK RKVPVVAAVR  60
ACMFMSCHQG SPAIDPSSGN AMQAAGLFIV GTLLFTAHSH STHAPPCYRP RLPSPAPVPG  120
GLPCPATAIP DPDPEQPPPP ARINGCRRPA SQPRPPPQTI PSPFPPPQQQ EQQLAYPTVK  180
STRAPPGPPS SPAVRACGAA ERSIHLTGGC VRCLPACLPP SLPVALASSS SSSLQPAVRV  240
SAAAEEERAV RACPPAPTRT PSSSPQLISR APRPPTRTGT STMPCSSAAP TWLLRVASAA  300
DQASSSSSSK GGGRVLTAGT TGTTMDTAAT AAAAGCGGNG GGGGGSNAAD LQESSSSGQS  360
RLAARGHWRP AEDAKLRELV ALYGPQNWNL IAEKLDGRSG KSCRLRWFNQ LDPRISKRPF  420
SDEEEERLMA AHRFYGNKWA MIARLFPGRT DNAVKNHWHV IMARKYREQS TAYRRRKLNQ  480
AVQRKLEASA AAVATMPPAA GSTGDVVGAA LGHHHHQLLA AAAAAAHDAA YGFAAADPYG  540
AFGFRQYYPF PPASAEDTPP PPPPPFCLFP GPSSAAALHA DSRRLPWPSS SSSDAAAAAA  600
GGGRYGEPQQ QLLLPVVHGG SWIDGVGVAV AGGHHEAQFV LGNNGGAFEG TTRQQGAAAG  660
AHFEAAAAAP PPAFIDFLGV GAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-323654657107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0419830.0BT041983.1 Zea mays full-length cDNA clone ZM_BFb0095C08 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445547.10.0hypothetical protein SORBIDRAFT_07g021280
TrEMBLC5YL860.0C5YL86_SORBI; Putative uncharacterized protein Sb07g021280
STRINGSb07g021280.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.16e-69myb domain protein 105